HiActi™ Recombinant Human Galectin-7 Protein, His Tag _ 92310ES

Galectin-7 (Gal-7), a member of the galectin family, is one of the prototype galectins. It contains a single carbohydrate recognition domain (CRD) responsible for binding β-galactosides, and exists as a homodimer to exert its biological activity. Gal-7 is constitutively expressed in the gastrointestinal tract, stratified epithelia, skin, and fetal heart. It has been reported to act as an effector in p53 pathway activation, thereby inducing apoptosis. Furthermore, Gal-7 plays a crucial role in various biological processes, including cell adhesion, migration, proliferation, and differentiation. Specifications Cat.No. 92310ES08 / 92310ES20 / 92310ES60 / 92310ES7692310ES08 Size 5 μg / 20 μg / 100 μg / 500 μg Components Name 92310ES08 92310ES20 92310ES60 92310ES76 HiActi™ Recombinant Human Galectin-7 Protein, His Tag 5 μg 20 μg 100 μg 500 μg Performance parameters Synonyms LGALS7B, LGALS7, PI7; GAL7, Gal-7, HKL-14 Species Human Expression Sequence SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF with polyhistidine tag at the N-terminus. Accession P47929 Tag N-His Expression System E.coli Molecular Weight The protein has a calculated MW of 15.9 kDa. The protein migrates as 18 kDa under reducing condition Purity >98% as determined by SDS-PAGE. Endotoxin <0.1 EU per 1 μg of the protein by the LAL method. Formulation The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. Appearance Lyophilized Powder Biological activity Measure by its ability to chemoattract human THP1 cells. Chemotactic activity was observed at a concentration of 0.5 μg/mL. Reconstitution Instructions 1)Briefly centrifuge the vial at 3000 rpm for 5 minutes before opening. 2)It is recommended to reconstitute the lyophilized powder with sterile water to a concentration of no less than 100 μg/mL, and let it stand for at least 20 minutes to ensure complete dissolution. 3)The reconstituted solution can be further diluted and aliquoted. When performing further dilution and aliquoting, a carrier protein (0.1% BSA, 10% FBS, or 5% HSA) must be added. For serum-free experimental requirements, a 5% trehalose solution can be used as an alternative carrier. Storage Store at -25 to -15°C. Valid for 1 year from receipt. After reconstitution, store at 2 to 8°C for up to 7 days, or at -85 to -65°C for up to 3 months. To avoid repeated freeze-thaw cycles, we recommend aliquoting the protein upon first use. Notes 1. This product is for research use only. 2. Please operate with lab coats and disposable gloves, for your safety. Documents Safety Data Sheet 92310_MSDS_HB260723 Manuals: 92310_Manual_HB20260615