EGF – 650mcg

EGF 650 mcg research-grade lyophilized protein powder supplied in a glass vial. Epidermal growth factor (EGF) is a signaling protein commonly studied in laboratory models involving EGFR activation, intracellular signaling, cellular proliferation, migration and differentiation. Research Use Only: All products are intended exclusively for laboratory and scientific research. Not for human or veterinary use. Purity Batch-specific; refer to the Certificate of Analysis (CoA) Form Lyophilized protein powder Content 650 mcg EGF per vial Packaging Glass vial with sterile closure Storage Store lyophilized at −20 °C (desiccated, protect from light) Molecular formula C₂₇₀ H₄₀₁ N₇₃ O₈₃ S₇ Molecular weight ~6,222 g·mol⁻¹ (6.22 kDa) Sequence Mature human epidermal growth factor consisting of 53 amino acids and containing three intramolecular disulfide bonds. NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR CAS number 62253-63-8 Laboratory handling conditions should follow the product-specific Certificate of Analysis and validated experimental protocol. Select the appropriate sterile research diluent according to the requirements of the intended in vitro or laboratory workflow. Research Overview Epidermal growth factor is a signaling protein studied primarily for its interaction with the epidermal growth factor receptor (EGFR). Binding of EGF to EGFR is used in laboratory models to investigate receptor activation, intracellular signal transduction and subsequent changes in cellular behavior. Primary Research Areas EGFR signaling: Laboratory studies examining receptor binding, receptor phosphorylation and downstream signaling pathways activated following EGF stimulation. Cell proliferation: Experimental models investigating growth-factor-dependent cell-cycle activity and cellular proliferation responses. Cell migration: In vitro research examining cellular movement, wound-closure models and signaling mechanisms associated with migration. Cell differentiation: Research into changes in cellular phenotype, morphology and function following EGFR pathway activation.