LL-37 – 5mg

Our premium peptides come in lyophilized (freeze-dried) powder form and must be reconstituted prior to use. This is to stabilize and protect our products from degradation. Unit Size 5 mg/vial Unit Quantity 1 Vial Sequence H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH ([LL-37, 37 aa]) Appearance White Powder Peptide Purity >99% Solubility Soluble in water LL-37 is sold for research use only. Not for human consumption. All product information on this Web site is for educational purposes only. This product is not a drug, supplement, food or cosmetic and it may not be misused, sold, labeled or branded as such. Pure Peps™ products are only available from this site.