Proteintech, Ag25031, Recombinant mouse Mcp1 protein

Size: 50ug Specification Peptide Sequence: QPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQM (24-95 aa encoded by NM-011333 ) Activity: Not tested. Endotoxin Level: Please contact the lab for more information. Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. Formulation: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.