HiActi™ Recombinant Human FGF-22 Protein, His-SUMO Tag _ 91355ES

Fibroblast growth factor-22 (FGF-22) is a member of the fibroblast growth factor family with a molecular weight of 22.3 kDa and contains 209 amino acid residues. FGF-22 is expressed in the brain, skin, horizontal cells, bipolar cells, rod photoreceptors, and Müller glial cells. It is involved in the fasting response, glucose homeostasis, lipolysis, lipogenesis, and hair development. Specifications Cat.No. 91355ES08 / 91355ES20 / 91355ES60 / 91355ES76 Size 5 μg / 20 μg / 100 μg / 500 μg Components Name 91355ES08 91355ES20 91355ES60 91355ES76 HiActi™ Recombinant Human FGF-22 Protein, His-SUMO Tag 5 μg 20 μg 100 μg 500 μg Performance parameters Synonyms fibroblast growth factor 22, UNQ2500/PRO5800, FGF22 Species Human Expression Sequence TPSASRGPRSYPHLEGDVRWRRLFSSTHFFLRVDPGGRVQGTRWRHGQDSILEIRSVHVGVVVIKAVSSGFYVAMNRRGRLYGSRLYTVDCRFRERIEENGHNTYASQRWRRRGQPMFLALDRRGGPRPGGRTRRYHLSAHFLPVLVS with polyhistidine tag and SUMO tag at the N-terminus. Accession Q9HCT0 Tag N-His-SUMO Expression System E.coli Molecular Weight The protein has a calculated MW of 29.35 kDa. The protein migrates as 36 kDa under reducing condition Purity >98% as determined by SDS-PAGE. Endotoxin <0.1 EU per 1 μg of the protein by the LAL method. Formulation The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. Appearance Lyophilized Powder Biological activity Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is <2 ng/mL. Reconstitution Instructions 1)Briefly centrifuge the vial at 3000 rpm for 5 minutes before opening. 2)It is recommended to reconstitute the lyophilized powder with sterile water to a concentration of no less than 100 μg/mL, and let it stand for at least 20 minutes to ensure complete dissolution. 3)The reconstituted solution can be further diluted and aliquoted. When performing further dilution and aliquoting, a carrier protein (0.1% BSA, 10% FBS, or 5% HSA) must be added. For serum-free experimental requirements, a 5% trehalose solution can be used as an alternative carrier. Storage Store at -25 to -15°C. Valid for 1 year from receipt. After reconstitution, store at 2 to 8°C for up to 7 days, or at -85 to -65°C for up to 3 months. To avoid repeated freeze-thaw cycles, we recommend aliquoting the protein upon first use. Notes 1. This product is for research use only. 2. Please operate with lab coats and disposable gloves, for your safety. Documents Safety Data Sheet 91355_MSDS_HB260723 Manuals: 91355_Manual_HB20260615