HiActi™ Recombinant Human FGF-11 isoform 2 Protein, His Tag _ 91353ES
The fibroblast growth factor (FGF) family comprises two classes: secreted FGFs and intracellular FGFs (iFGFs). iFGFs are associated with voltage-gated sodium channels (Nav). Human FGF-11 isoform 2 is a cytokine with a molecular weight of 18 kDa and contains 166 amino acid residues. Specifications Cat.No. 91353ES08 / 91353ES20 / 91353ES60 / 91353ES76 Size 5 μg / 20 μg / 100 μg / 500 μg Components Name 91353ES08 91353ES20 91353ES60 91353ES76 HiActi™ Recombinant Human FGF-11 isoform 2 Protein, His Tag 5 μg 20 μg 100 μg 500 μg Performance parameters Synonyms fibroblast growth factor 11 isoform 2, FHF-3, FHF3, FGF11 Species Human Expression Sequence MSLSPEPQLKGIVTKLFCRQGFYLQANPDGSIQGTPEDTSSFTHFNLIPVGLRVVTIQSAKLGHYMAMNAEGLLYSSPHFTAECRFKECVFENYYVLYASALYRQRRSGRAWYLGLDKEGQVMKGNRVKKTKAAAHFLPKLLEVAMYQEPSLHSVPEASPSSPPAP with polyhistidine tag at the C-terminus. Accession Q92914 Tag C-His Expression System E.coli Molecular Weight The protein has a calculated MW of 19.34 kDa. The protein migrates as 23 kDa under reducing condition. Purity >98% as determined by SDS-PAGE. Endotoxin <0.1 EU per 1 μg of the protein by the LAL method. Formulation The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. Appearance Lyophilized Powder Biological activity Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is <1 ng/mL. Reconstitution Instructions 1)Briefly centrifuge the vial at 3000 rpm for 5 minutes before opening. 2)It is recommended to reconstitute the lyophilized powder with sterile water to a concentration of no less than 100 μg/mL, and let it stand for at least 20 minutes to ensure complete dissolution. 3)The reconstituted solution can be further diluted and aliquoted. When performing further dilution and aliquoting, a carrier protein (0.1% BSA, 10% FBS, or 5% HSA) must be added. For serum-free experimental requirements, a 5% trehalose solution can be used as an alternative carrier. Storage Store at -25 to -15°C. Valid for 1 year from receipt. After reconstitution, store at 2 to 8°C for up to 7 days, or at -85 to -65°C for up to 3 months. To avoid repeated freeze-thaw cycles, we recommend aliquoting the protein upon first use. Notes 1. This product is for research use only. 2. Please operate with lab coats and disposable gloves, for your safety. Documents Manuals: 91353_Manual_HB20260615
Specifications
- Size
- 5 μg, 20 μg, 100 μg, 500 μg
Variants (4)
- 5 μg — 125.00 USD — In stock
- 20 μg — 315.00 USD — In stock
- 100 μg — 985.00 USD — In stock
- 500 μg — 2835.00 USD — In stock
How AI sees this product
The more complete this product's details, the more confidently AI assistants can understand and recommend it.