HiActi™ Recombinant Human FGF-14 Protein, His Tag _ 91354ES
Fibroblast growth factor-14 (FGF-14) is a member of the fibroblast growth factor family with a molecular weight of 27.7 kDa and contains 247 amino acid residues. FGF-14 is primarily expressed in the brain and cervix. It is involved in the development and function of the nervous system, and may regulate the trafficking and function of voltage-gated sodium channels. Specifications Cat.No. 91354ES08 / 91354ES20 / 91354ES60 / 91354ES76 Size 5 μg / 20 μg / 100 μg / 500 μg Components Name 91354ES08 91354ES20 91354ES60 91354ES76 HiActi™ Recombinant Human FGF-14 Protein ,His Tag 5 μg 20 μg 100 μg 500 μg Performance parameters Synonyms fibroblast growth factor 14, FHF-4, FHF4, SCA27, FGF14 Species Human Expression Sequence AAAIASGLIRQKRQAREQHWDRPSASRRRSSPSKNRGLCNGNLVDIFSKVRIFGLKKRRLRRQDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKT with polyhistidine tag at the N-terminus. Accession Q92915 Tag N-His Expression System E.coli Molecular Weight The protein has a calculated MW of 28.28 kDa. The protein migrates as 33 kDa under reducing condition. Purity >98% as determined by SDS-PAGE. Endotoxin <0.1 EU per 1 μg of the protein by the LAL method. Formulation The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. Appearance Lyophilized Powder Biological activity Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is <21 ng/mL. Reconstitution Instructions 1)Briefly centrifuge the vial at 3000 rpm for 5 minutes before opening. 2)It is recommended to reconstitute the lyophilized powder with sterile water to a concentration of no less than 100 μg/mL, and let it stand for at least 20 minutes to ensure complete dissolution. 3)The reconstituted solution can be further diluted and aliquoted. When performing further dilution and aliquoting, a carrier protein (0.1% BSA, 10% FBS, or 5% HSA) must be added. For serum-free experimental requirements, a 5% trehalose solution can be used as an alternative carrier. Storage Store at -25 to -15°C. Valid for 1 year from receipt. After reconstitution, store at 2 to 8°C for up to 7 days, or at -85 to -65°C for up to 3 months. To avoid repeated freeze-thaw cycles, we recommend aliquoting the protein upon first use. Notes 1. This product is for research use only. 2. Please operate with lab coats and disposable gloves, for your safety. Documents Safety Data Sheet 91354_MSDS_HB260723 Manuals: 91354_Manual_HB20260615
Specifications
- Size
- 5 μg, 20 μg, 100 μg, 500 μg
Variants (4)
- 5 μg — 125.00 USD — In stock
- 20 μg — 315.00 USD — In stock
- 100 μg — 985.00 USD — In stock
- 500 μg — 2835.00 USD — In stock
How AI sees this product
The more complete this product's details, the more confidently AI assistants can understand and recommend it.